The UBQ domain within your query sequence starts at position 152 and ends at position 223, and its E-value is 3.24e-4.

SQLRLRLSTGKDLRLVVRSTDTVFHMKRRLHATEGVEPGSQRWFFSGRPLTDKMKLEELKIPKDYVVQVIVS
UBQ

UBQ

Ubiquitin homologues
SMART ACC:SM000213
Description:Ubiquitin-mediated proteolysis is involved in the regulated turnover of proteins required for controlling cell cycle progression
InterPro ACC:IPR000626
InterPro abstract:

Ubiquitin is expressed as three different precursors: a polymeric head-to-tail concatemer of identical units (polyubiquitin), and two N-terminal ubiquitin moieties, UbL40 and UbS27, that are fused to the ribosomal polypeptides L40 and S27, respectively. Specific endopeptidases cleave these precursor molecules [ PUBMED:15571815 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 49 174 UBQ domains in 38 515 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UBQ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UBQ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the UBQ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UBQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBQ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamubiquitin
PROSITEUBQ_DOMAIN
InterProIPR000626