The Enolase_C domain within your query sequence starts at position 71 and ends at position 312, and its E-value is 9.08e-120.

SRIAPALISSGISVVEQEKLDNLMLELDGTENKSLELVKEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLGALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP
Enolase_C

Enolase_C

Enolase, C-terminal TIM barrel domain
SMART ACC:SM001192
Description: -
InterPro ACC:IPR020810
InterPro abstract:

Enolase (2-phospho-D-glycerate hydrolase) is an essential, homodimeric enzyme that catalyses the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways [ PUBMED:1859865 PUBMED:1840492 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 27 109 Enolase_C domains in 27 107 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Enolase_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Enolase_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Enolase_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Enolase_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR020810
PfamEnolase_C