The TOP1Ac domain within your query sequence starts at position 84 and ends at position 340, and its E-value is 2.28e-104.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 20045187 ) for details.

SRKEKAKQRPLALNTVEMLRVASSALGMGPQHAMQIAERLYTQGYISYPRTETTHYPENFDLKGSLRQQANHPYWADSVKQLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEYITRHFIATVSHDCKYLQSTISFRIGPEHFTCMGKTVISPGFTEIMPWQSVPLEESLPTCQKGDTFTVGEVKMLEKQTSPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNLGIVLV
TOP1Ac

TOP1Ac

Bacterial DNA topoisomerase I DNA-binding domain
SMART ACC:SM000437
Description:Bacterial DNA topoisomerase I and III, Eukaryotic DNA topoisomeraes III, reverse gyrase alpha subunit
InterPro ACC:IPR003602
InterPro abstract:

DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single-or double-strand breaks, crossing the strands through one another, then resealing the breaks [ PUBMED:7770916 ]. These enzymes have several functions: to remove … expand

GO process:DNA topological change (GO:0006265)
GO function:DNA binding (GO:0003677), DNA topoisomerase activity (GO:0003916)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 927 TOP1Ac domains in 39 925 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TOP1Ac domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TOP1Ac domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TOP1Ac domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TOP1Ac domain which could be assigned to a KEGG orthologous group, and not all proteins containing TOP1Ac domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTopoisom_bac
InterProIPR003602
PROSITETOPOISOMERASE_I_PROK