The Arg_tRNA_synt_N domain within your query sequence starts at position 78 and ends at position 166, and its E-value is 1.6e-27.

SRLQEVFGCAIRAAYPDLENPPLIVTPSQQPKFGDYQCNSAMGISQMLKAKEQKVSPREIAENITKHLPNNKYIDKVEIAGPGFINVHL
Arg_tRNA_synt_N

Arg_tRNA_synt_N

Arginyl tRNA synthetase N terminal dom
SMART ACC:SM001016
Description:This domain is found at the amino terminus of Arginyl tRNA synthetase, also called additional domain 1 (Add-1). It is about 140 residues long and it has been suggested that this domain will be involved in tRNA recognition.
InterPro ACC:IPR005148
InterPro abstract:

The aminoacyl-tRNA synthetases (also known as aminoacyl-tRNA ligases) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction [ PUBMED:10704480 PUBMED:12458790 ]. These proteins differ … expand

GO process:arginyl-tRNA aminoacylation (GO:0006420)
GO component:cytoplasm (GO:0005737)
GO function:nucleotide binding (GO:0000166), ATP binding (GO:0005524), arginine-tRNA ligase activity (GO:0004814)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 26 085 Arg_tRNA_synt_N domains in 26 083 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Arg_tRNA_synt_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Arg_tRNA_synt_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Arg_tRNA_synt_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Arg_tRNA_synt_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005148
PfamArg_tRNA_synt_N