The LamG domain within your query sequence starts at position 860 and ends at position 996, and its E-value is 1.47e-34.

SRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALIFSYNLGSGVASIMVNGSFSDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGLMRQLNINGALYVGGMKEIALHTNRQYLRGLVGCISHFTLSTD
LamG

LamG

Laminin G domain
SMART ACC:SM000282
Description: -
InterPro ACC:IPR001791
InterPro abstract:
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 74 121 LamG domains in 31 952 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LamG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LamG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LamG domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LamG domain.

ProteinDescriptionDisease / phenotype
LAMA2_HUMANOMIM:156225 : Muscular dystrophy, congenital merosin-deficient

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LamG domain which could be assigned to a KEGG orthologous group, and not all proteins containing LamG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001791
Pfamlaminin_G