The GARS_A domain within your query sequence starts at position 105 and ends at position 298, and its E-value is 4.42e-132.

SSKKFAKEFMDRHEIPTAQWRAFTNPEDACSFITSANFPALVVKASGLAAGKGVIVAKSQAEACRAVQEIMQEKSFGAAGETVVVEEFLEGEEVSCLCFTDGKTVAEMPPAQDHKRLLDGDEGPNTGGMGAYCPAPQVSKDLLVKIKNTILQRAVDGMQQEGAPYTGILYAGIMLTKDGPKVLEFNCRFGDPEC
GARS_A

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
SMART ACC:SM001209
Description:Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase (Pfam PF02786).
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 753 GARS_A domains in 22 745 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GARS_A domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GARS_A domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GARS_A domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GARS_A domain which could be assigned to a KEGG orthologous group, and not all proteins containing GARS_A domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGARS_A