The SAPA domain within your query sequence starts at position 27 and ends at position 60, and its E-value is 1.27e-16.

SSLECAQGPQFWCQSLEHAVQCRALGHCLQEVWG
SAPA

SAPA

Saposin/surfactant protein-B A-type DOMAIN
SMART ACC:SM000162
Description:Present as four and three degenerate copies, respectively, in prosaposin and surfactant protein B. Single copies in acid sphingomyelinase, NK-lysin amoebapores and granulysin. Putative phospholipid membrane binding domains.
InterPro ACC:IPR003119
InterPro abstract:

The saposin A-type domain is a ~40 amino acid domain present in the saposin precursor, prosaposin, in the propeptides that are cleaved off in the activation reaction. The domain is named after the small lysosomal proteins, saposins, which serve as sphingolipid hydrolase activator proteins in vertebrates. The mammalian saposins are synthesized as a single precursor molecule (prosaposin) which … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 737 SAPA domains in 1 080 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SAPA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SAPA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SAPA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SAPA domain which could be assigned to a KEGG orthologous group, and not all proteins containing SAPA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR003119