The PI3K_rbd domain within your query sequence starts at position 51 and ends at position 170, and its E-value is 5e-47.

SSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKES
PI3K_rbd

PI3K_rbd

PI3-kinase family, Ras-binding domain
SMART ACC:SM000144
Description:Certain members of the PI3K family possess Ras-binding domains in their N-termini. These regions show some similarity (although not highly significant similarity) to Ras-binding RA domains (unpublished observation).
InterPro ACC:IPR000341
InterPro abstract:

Phosphatidylinositol 3-kinases (PI3Ks) are lipid kinases that phosphorylate 4,5-bisphonate (PI(4,5) P2 or PIP2) at the 3-position of the inositol ring, and thus generate phosphatidylinositol 3,4,5-trisphosphate (PIP3), which, in turns, initiates a vast array of signaling events. PI3Ks can be grouped into three classes based on their domain organisation. Class I PI3Ks are heterodimers consisting … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 332 PI3K_rbd domains in 3 329 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PI3K_rbd domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PI3K_rbd domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding, Ras-binding

Relevant references for this domain

Primary literature for the PI3K_rbd domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PI3K_rbd domain which could be assigned to a KEGG orthologous group, and not all proteins containing PI3K_rbd domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000341