The CNX domain within your query sequence starts at position 43 and ends at position 76, and its E-value is 3.47e-19.

SSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIR
CNX

CNX

Connexin homologues
SMART ACC:SM000037
Description:Connexin channels participate in the regulation of signaling between developing and differentiated cell types.
InterPro ACC:IPR013092
InterPro abstract:

This domain is found in the N-terminal in connexins.

Two sets of nomenclature have been used to identify the connexins. The first, and most commonly used, classifies the connexin molecules according to molecular weight, such as connexin43 (abbreviated to Cx43), indicating a connexin of molecular weight close to 43kDa. However, studies have revealed cases where clear functional homologues … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 548 CNX domains in 6 512 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CNX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CNX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CNX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CNX domain.

ProteinDescriptionDisease / phenotype
CXB1_HUMANOMIM:304040 : Charcot-Marie-Tooth neuropathy, X-linked-1, dominant
OMIM:302800 : no description
CXA3_HUMANOMIM:601885 : Cataract, zonular pulverulent-2
OMIM:121015 : Cataract, zonular pulverulent-3
OMIM:601885 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CNX domain which could be assigned to a KEGG orthologous group, and not all proteins containing CNX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamconnexin
PROSITECNX_DOMAIN
InterProIPR013092