The CNH domain within your query sequence starts at position 506 and ends at position 813, and its E-value is 4.93e-106.

STAAWTHPSTKDQNLLLGAEEGIFILNRNDQEATLEMIFPGRTTWLYCINNLLMSLSGKTPYLYSHSILGLLERKDGRTGSPIAHISPHRLLARKNMVSSKIQDTKGCRACCVAESASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLPVFTLLTTPGSELPAVCIGVSPGQAAKSVLFHTVRFGALSCWLDDSSTEHKGPVQVIQVKEDMVMVLMDGSLKLVTPEGAPAPGLRTPEIPMTEAVEAVAMVEDRLEAFWKHGVQVWAPGLKQPLQELRDPTLTFRLLCSPRPVVVETRP
CNH

CNH

Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2
SMART ACC:SM000036
Description:Unpublished observations.
InterPro ACC:IPR001180
InterPro abstract:

Based on sequence similarities a domain of homology has been identified in the following proteins [ PUBMED:10391936 PUBMED:11448994 ]:

  • Citron and Citron kinase. These two proteins interact with the GTP-bound forms of the small … expand
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 359 CNH domains in 9 356 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CNH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CNH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the CNH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CNH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CNH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001180