The AMOP domain within your query sequence starts at position 162 and ends at position 310, and its E-value is 4.09e-82.

SVAWARAQCLAWEALEDQLPNFLTELPDCPCTLAQARADSGRFFTDYGCDIEHGSVCTYHPGAVHCVRSVQASPRYGSGQQCCYTAAGTQLLTSDSTSGSTPDRGHDWGAPPYRTPPRVPGMSHWLYDVISFYYCCLWAPECPRYMKRR
AMOP

AMOP

Adhesion-associated domain present in MUC4 and other proteins
SMART ACC:SM000723
Description: -
InterPro ACC:IPR005533
InterPro abstract:

This entry represents the AMOP domain found in ISM1/2, Mucin-4, Susd2 and related proteins. The AMOP domain (for adhesion-associated domain in MUC4 and other proteins) is a ~100-residue-long extracellular domain that contains eight invariant cysteine residues that are predicted to be involved in disulphide bonds. The AMOP domain is found associated with extracellular domains involved in cell … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 485 AMOP domains in 1 480 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AMOP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AMOP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the AMOP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AMOP domain which could be assigned to a KEGG orthologous group, and not all proteins containing AMOP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005533