The TSPN domain within your query sequence starts at position 31 and ends at position 214, and its E-value is 4.25e-72.

SVDVLRALRFPSLPDGVRRSKGVCPGDVAYRVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVQQLGLELGRPVRFLYEDQRGRPQASAQPIFRGLSLADGKWHHVAVAVKGQSVTLIVDCKKRVTRPLPRSVHPVLDTHGVVIFGAHILDDEVFEGDVQELLVVPGV
TSPN

TSPN

Thrombospondin N-terminal -like domains.
SMART ACC:SM000210
Description:Heparin-binding and cell adhesion domain of thrombospondin
InterPro ACC:IPR048287
InterPro abstract:

This entry represents the heparin-binding and cell adhesion domain of thrombospondin and related proteins such as protein kinase C-binding protein NELL1 and NELL2, and collagen alpha.

Thrombospondins (TSPs) are secreted, calcium-binding glycoproteins that play an essential role in regulating cell-cell and cell-matrix interactions. They are divided into trimeric subgroup A (TSP-1 and TSP-2) … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 670 TSPN domains in 10 645 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TSPN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TSPN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TSPN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TSPN domain which could be assigned to a KEGG orthologous group, and not all proteins containing TSPN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR048287