The Sec3-PIP2_bind domain within your query sequence starts at position 30 and ends at position 121, and its E-value is 5.63e-11.

SVQDRYFLCVSVTKTDEVKITMVKHYRVGLDEKYEVTKRWSLSDLRMIDGKEADTDNPFFDLHFKKVYSLEAYSCASKYSFARTVSRLNHVY
Sec3-PIP2_bind

Sec3-PIP2_bind

Exocyst complex component SEC3 N-terminal PIP2 binding PH
SMART ACC:SM001313
Description:This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues in the PH domain predicted to bind the PIP2 head group are conserved. The exocyst complex is essential for many exocytic events, by tethering vesicles at the plasma membrane for fusion. In fission yeast, polarised exocytosis for growth relies on the combined action of the exocyst at cell poles and myosin-driven transport along actin cables PMID:22768263.
InterPro ACC:IPR028258
InterPro abstract:

This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the targeting and tethering of post-Golgi secretory vesicles to fusion sites on the plasma membrane prior to SNARE-mediated fusion. This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 190 Sec3-PIP2_bind domains in 2 188 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Sec3-PIP2_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Sec3-PIP2_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Sec3-PIP2_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing Sec3-PIP2_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSec3-PIP2_bind
InterProIPR028258