The SCP domain within your query sequence starts at position 37 and ends at position 178, and its E-value is 4.88e-40.

SVQEEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSG
SCP

SCP

SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains.
SMART ACC:SM000198
Description:Human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein represent functional links between plant defense systems and human immune system. This family has no known function.
InterPro ACC:IPR014044
InterPro abstract:

This entry represents the CAP domain common to all members of the CAP superfamily. The CAP domain forms a unique 3 layer α-β-α fold with some, though not all, of the structural elements found in proteases [ PUBMED:18824526 ].

The cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 694 SCP domains in 17 729 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SCP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SCP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SCP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SCP domain which could be assigned to a KEGG orthologous group, and not all proteins containing SCP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSCP
InterProIPR014044
PROSITESCP_DOMAIN