The c-SKI_SMAD_bind domain within your query sequence starts at position 217 and ends at position 312, and its E-value is 2.5e-61.

SVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFD
c-SKI_SMAD_bind

c-SKI_SMAD_bind

c-SKI Smad4 binding domain
SMART ACC:SM001046
Description:c-SKI is an oncoprotein that inhibits TGF-beta signaling through interaction with Smad proteins (PUBMED:15107821). This domain binds to Smad4 (PUBMED:12419246) .
InterPro ACC:IPR014890
InterPro abstract:

This entry represents the SMAD4-binding domain of c-SKI, which is an oncogene that inhibits TGF-beta signalling through interaction with SMAD proteins [ PUBMED:15107821 PUBMED:12419246 ].

GO function:SMAD binding (GO:0046332)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 959 c-SKI_SMAD_bind domains in 1 955 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing c-SKI_SMAD_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing c-SKI_SMAD_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a c-SKI_SMAD_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing c-SKI_SMAD_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014890
Pfamc-SKI_SMAD_bind