The Elp3 domain within your query sequence starts at position 70 and ends at position 273, and its E-value is 1.63e-8.

SYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVARLHGLEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYKPVKVNCVVMRGLNEDELLDFVALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQ
Elp3

Elp3

Elongator protein 3, MiaB family, Radical SAM
SMART ACC:SM000729
Description:This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
InterPro ACC:IPR006638
InterPro abstract:

This domain is found in FeMo cofactor biosynthesis protein NifB, PqqA peptide cyclase, Oxygen-independent coproporphyrinogen III oxidase (HemN), biotin synthase (BioB), Lipoyl synthase (LipA), Ribosomal protein S12 methylthiotransferase RimO, GTP 3',8-cyclase (MoaA) and tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (MiaB), and similar proteins found in cellular organisms. This group … expand

GO function:catalytic activity (GO:0003824), iron-sulfur cluster binding (GO:0051536)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 276 946 Elp3 domains in 276 201 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Elp3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Elp3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport
Binding / catalysis:Methyltransferase

Relevant references for this domain

Primary literature for the Elp3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Elp3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Elp3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006638
PfamRadical_SAM