The DUF1716 domain within your query sequence starts at position 52 and ends at position 162, and its E-value is 3.97e-61.

TADDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVV
DUF1716

DUF1716

Eukaryotic domain of unknown function (DUF1716)
SMART ACC:SM001156
Description:This domain is found in eukaryotic proteins. A human nuclear protein with this domain (Q8WYA6) is thought to have a role in apoptosis [(PUBMED:12659813)].
InterPro ACC:IPR013180
InterPro abstract:

This entry represents the N-terminal domain of the beta-catenin-like protein 1 (CTNNBL1). CTNNBL1 is a component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. In humans, it participates in AID/AICDA-mediated Ig class switching recombination (CSR) and may induce apoptosis [ PUBMED:12659813 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 502 DUF1716 domains in 1 499 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1716 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1716 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF1716 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1716 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1716 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013180
PfamDUF1716