The WSC domain within your query sequence starts at position 242 and ends at position 337, and its E-value is 2.09e-28.

TATYRGCFPLPENVTHTFSSSMTQANMTVETCSGFCSQKEFPLAILRGWDCYCAYPTPQFSLRDAVDGALCSQAPETQGLPGYCEVYQTPVQDTRC
WSC

WSC

present in yeast cell wall integrity and stress response component proteins
SMART ACC:SM000321
Description:Domain present in WSC proteins, polycystin and fungal exoglucanase
InterPro ACC:IPR002889
InterPro abstract:

The WSC domain is a putative carbohydrate binding domain. The domain contains up to eight conserved cysteine residues that may be involved in disulphide bridges [ PUBMED:10469603 ]. The Trichoderma harzianum beta-1,3 exoglucanase contains two copies of the WSC domain, while the yeast SLG1 protein contains only one. This … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 536 WSC domains in 2 069 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WSC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WSC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the WSC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WSC domain which could be assigned to a KEGG orthologous group, and not all proteins containing WSC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002889