The RGS domain within your query sequence starts at position 54 and ends at position 170, and its E-value is 7.71e-20.

TFDKIFNQKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLRRSRQMYDAYIMRELLSSTHQFSKQAVEHVQSHLSKKQVTATLFQPYIEEICESLRGDIFQKFMERYA
RGS

RGS

Regulator of G protein signalling domain
SMART ACC:SM000315
Description:RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.
InterPro ACC:IPR016137
InterPro abstract:

This entry represents a structural domain with a multi-helical fold consisting of a 4-helical bundle with a left-handed twist and an up-and-down topology. This domain can be divided into two all-α subdomains. This domain is found in regulation of G-protein signalling (RGS) proteins, as well as other related proteins, including:

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 967 RGS domains in 17 915 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RGS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RGS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, G-protein alpha subunit-binding, GTPase activator for G-protein subunits

Relevant references for this domain

Primary literature for the RGS domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the RGS domain.

ProteinDescriptionDisease / phenotype
RK_HUMANOMIM:180381 : Oguchi disease-2
OMIM:258100 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RGS domain which could be assigned to a KEGG orthologous group, and not all proteins containing RGS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRGS
InterProIPR016137