The GHB domain within your query sequence starts at position 32 and ends at position 129, and its E-value is 7.57e-9.

TFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECET
GHB

GHB

Glycoprotein hormone beta chain homologues.
SMART ACC:SM000068
Description:Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
InterPro ACC:IPR001545
InterPro abstract:

The crystal structures of four growth factors; nerve growth factor, transforming growth factor-beta, platelet-derived growth factor, and human chorionic gonadotropin from four separate superfamilies revealed that these proteins are structurally related and share a common overall topology [ PUBMED:8490958 ]. These proteins … expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 683 GHB domains in 1 681 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GHB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GHB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GHB domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the GHB domain.

ProteinDescriptionDisease / phenotype
LSHB_HUMANOMIM:152780 : Hypogonadism, hypergonadotropic ; ?Male pseudohermaphroditism due to defective LH

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GHB domain which could be assigned to a KEGG orthologous group, and not all proteins containing GHB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCys_knot
PROSITEGHB_DOMAIN
InterProIPR001545