The Ald_Xan_dh_C domain within your query sequence starts at position 593 and ends at position 696, and its E-value is 6.99e-42.

TGEAIYCDDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITADHLQEANTFGTETFLATDEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQDLA
Ald_Xan_dh_C

Ald_Xan_dh_C

Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain
SMART ACC:SM001008
Description:Aldehyde oxidase catalyses the conversion of an aldehyde in the presence of oxygen and water to an acid and hydrogen peroxide. The enzyme is a homodimer, and requires FAD, molybdenum and two 2FE-2S clusters as cofactors. Xanthine dehydrogenase catalyses the hydrogenation of xanthine to urate, and also requires FAD, molybdenum and two 2FE-2S clusters as cofactors. This activity is often found in a bifunctional enzyme with xanthine oxidase activity too. The enzyme can be converted from the dehydrogenase form to the oxidase form irreversibly by proteolysis or reversibly through oxidation of sulphydryl groups.
InterPro ACC:IPR000674
InterPro abstract:

Aldehyde oxidase ( EC:1.2.3.1 ) catalyses the conversion of an aldehyde in the presence of oxygen and water to an acid and hydrogen peroxide. The enzyme is a homodimer, and requires FAD, molybdenum and two 2FE-2S clusters as cofactors. Xanthine dehydrogenase ( EC:1.1.1.204 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 48 546 Ald_Xan_dh_C domains in 48 472 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ald_Xan_dh_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ald_Xan_dh_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Ald_Xan_dh_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ald_Xan_dh_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ald_Xan_dh_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000674
PfamAld_Xan_dh_C