The BRK domain within your query sequence starts at position 586 and ends at position 630, and its E-value is 3.77e-23.

TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT
BRK

BRK

domain in transcription and CHROMO domain helicases
SMART ACC:SM000592
Description: -
InterPro ACC:IPR006576
InterPro abstract:

The function of this domain is unknown [ PUBMED:11779830 ]. It is often found associated with helicases and transcription factors.

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 509 BRK domains in 2 609 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BRK domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRK domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006576