The Ribosomal_L32e domain within your query sequence starts at position 17 and ends at position 119, and its E-value is 6.23e-59.

TKKFPRHQSDRYVTVERNWWEPRGIDNRVQRRLKGQIPMPNIGYQSNKKTKHTLPSGFSKFLVHNAKELEVLLMCNKSYRAEIAHEPKTIIQRATQLAIRVTN
Ribosomal_L32e

Ribosomal_L32e

SMART ACC:SM001393
Description:This family includes ribosomal protein L32 from eukaryotes and archaebacteria.
InterPro ACC:IPR001515
InterPro abstract:

eL32 is a protein from the large ribosomal subunit that contains a surface-exposed globular domain and a finger-like projection that extends into the RNA core to stabilize the tertiary structure. eL32 does not appear to play a role in forming the A (aminacyl), P (peptidyl) or E (exit) sites of the ribosome, but does interact with 23S rRNA, which has a "kink-turn" secondary structure … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 944 Ribosomal_L32e domains in 2 940 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_L32e domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_L32e domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_L32e domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_L32e domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001515
PfamRibosomal_L32e