The K167R domain within your query sequence starts at position 1462 and ends at position 1570, and its E-value is 9.09e-38.

TKKMFFNSPQPESAITRKSRERQSRASISKIDVKEELLESEEHLQLGEGVDTFQVSTNKVIRSSRKPAKRKLDSTAGMPNSKRMRCSSKDNTPCLEDLNGFQELFQMPG
K167R

K167R

K167/Chmadrin repeat
SMART ACC:SM001295
Description:This family represents the K167/Chmadrin repeat. (PMID:15112237) The function of this repeat is unknown.
InterPro ACC:IPR012568
InterPro abstract:

This entry represents the KI67/Chmadrin repeat [ PUBMED:15112237 ]. It can be found in the human antigen KI-67 protein [ PUBMED:8227122 ]. The function of this repeat is unknown.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 375 K167R domains in 356 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing K167R domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing K167R domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a K167R domain which could be assigned to a KEGG orthologous group, and not all proteins containing K167R domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR012568
PfamPF08065