The UAS domain within your query sequence starts at position 137 and ends at position 260, and its E-value is 3.05e-50.

TLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGE
UAS

UAS

SMART ACC:SM000594
Description: -
InterPro ACC:IPR006577
InterPro abstract:

UAS is a domain of unknown function found in FAF1 proteins (FAS-associated factor 1) and in other proteins, many of which are described as having no known function.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 314 UAS domains in 3 305 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UAS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UAS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the UAS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UAS domain which could be assigned to a KEGG orthologous group, and not all proteins containing UAS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006577