The FAS1 domain within your query sequence starts at position 2367 and ends at position 2462, and its E-value is 2.06e-6.

TLFVPVNKGFVDNMTLSGPDLELHASNATFLSINASRGTLLPAHSGLSLFISDTGPDNTSLVPLAPGAVVVSHVIVWDIMAFNGIIHALASPLLMP
FAS1

FAS1

Four repeated domains in the Fasciclin I family of proteins, present in many other contexts.
SMART ACC:SM000554
Description: -
InterPro ACC:IPR000782
InterPro abstract:

The FAS1 (fasciclin-like) domain is an extracellular module of about 140 amino acid residues. It has been suggested that the FAS1 domain represents an ancient cell adhesion domain common to plants and animals [ PUBMED:7925267 ]; related FAS1 domains are also found in bacteria [ PUBMED:7822037 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 36 584 FAS1 domains in 21 188 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FAS1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FAS1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FAS1 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FAS1 domain.

ProteinDescriptionDisease / phenotype
BGH3_HUMANOMIM:601692 : Corneal dystrophy, Groenouw type I
OMIM:121900 : Corneal dystrophy, lattice type I
OMIM:122200 : Corneal dystrophy, Reis-Bucklers type
OMIM:121900 : Corneal dystrophy, Avellino type

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FAS1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing FAS1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000782