The POLXc domain within your query sequence starts at position 10 and ends at position 334, and its E-value is 4.58e-159.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 94278498 ) for details.

TLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEIKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKDGKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRS
POLXc

POLXc

DNA polymerase X family
SMART ACC:SM000483
Description:includes vertebrate polymerase beta and terminal deoxynucleotidyltransferases
InterPro ACC:IPR002054
InterPro abstract:

DNA carries the biological information that instructs cells how to exist in an ordered fashion: accurate replication is thus one of the most important events in the cell life cycle. This function is mediated by DNA-directed DNA-polymerases, which add nucleotide triphosphate (dNTP) residues to the 5'-end of the growing DNA chain, using a complementary DNA as template. Small RNA molecules are generally … expand

GO function:DNA binding (GO:0003677), DNA-directed DNA polymerase activity (GO:0003887)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 622 POLXc domains in 6 621 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing POLXc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing POLXc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the POLXc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a POLXc domain which could be assigned to a KEGG orthologous group, and not all proteins containing POLXc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEDNA_POLYMERASE_X
InterProIPR002054
PfamDNA_polymeraseX