The AXH domain within your query sequence starts at position 545 and ends at position 664, and its E-value is 1.42e-82.

TLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLK
AXH

AXH

domain in Ataxins and HMG containing proteins
SMART ACC:SM000536
Description:unknown function
InterPro ACC:IPR003652
InterPro abstract:

Spinocerebellar ataxia type 1 is late-onset neurodegenerative diseases caused by the expansion of a CAG triplet repeat in the SCA1 gene. This results in the lengthening of a polyglutamine tract in the gene product ataxin-1 producing a toxic gain of function that results in neuronal death.

GO function:RNA binding (GO:0003723), protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 247 AXH domains in 247 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AXH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AXH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the AXH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AXH domain which could be assigned to a KEGG orthologous group, and not all proteins containing AXH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003652