The C8 domain within your query sequence starts at position 1521 and ends at position 1596, and its E-value is 6.91e-23.

TMSGPKLCGQLVNPSGPFEACLLHLKASSFLDNCVTDMCSFQGLQQKLCAHMSAMTATCQDAGYPVKPWREPQFCP
C8

C8

SMART ACC:SM000832
Description:This domain contains 8 conserved cysteine residues, but this family only contains 7 of them to overlaps with other domains. It is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin.
InterPro ACC:IPR014853
InterPro abstract:

The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 065 C8 domains in 7 663 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C8 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C8 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C8 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C8 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamC8
InterProIPR014853