The QLQ domain within your query sequence starts at position 170 and ends at position 206, and its E-value is 3.98e-14.

TPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQG
QLQ

QLQ

SMART ACC:SM000951
Description:QLQ is named after the conserved Gln, Leu, Gln motif. QLQ is found at the N-terminus of SWI2/SNF2 protein, which has been shown to be involved in protein-protein interactions. QLQ has been postulated to be involved in mediating protein interactions (PUBMED:12974814).
InterPro ACC:IPR014978
InterPro abstract:

The QLQ domain is characterised by the conserved Gln-Leu-Gln residues. Another feature of this domain is the absolute conservation of bulky aromatic/hydrophobic and acidic amino acid residues such as Phe, Trp, Tyr, Leu, Glu, or their equivalents in terms of chemical and radial properties. The Pro residue is also absolutely conserved. These amino acid residues are critical for the function of … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 266 QLQ domains in 3 253 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing QLQ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing QLQ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the QLQ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a QLQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing QLQ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014978
PfamQLQ