The Drf_GBD domain within your query sequence starts at position 26 and ends at position 227, and its E-value is 2.99e-88.

TPMPEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHTYIQKLQSFLDPNVTRKKFRRRVQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCL
Drf_GBD

Drf_GBD

Diaphanous GTPase-binding Domain
SMART ACC:SM001140
Description:This domain is bound to by GTP-attached Rho proteins, leading to activation of the Drf protein.
InterPro ACC:IPR010473
InterPro abstract:

Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [ PUBMED:10631086 ]. Drf proteins are characterised by a variety of shared domains: an N-terminal … expand

GO process:actin cytoskeleton organization (GO:0030036)
GO function:small GTPase binding (GO:0031267), actin binding (GO:0003779)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 608 Drf_GBD domains in 6 601 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Drf_GBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Drf_GBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Drf_GBD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Drf_GBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing Drf_GBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDrf_GBD
InterProIPR010473