The RB_A domain within your query sequence starts at position 414 and ends at position 606, and its E-value is 3.42e-106.

TPVSTAAHSLSRLHTMLSGLRNAPSEKLERILRSCSRDPTQAIADRLKEMYEIYSQHFQPDENFSNCAKEIANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEHDAFHRSLLACCLEVVAFSHKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKSPLWDRI
RB_A

RB_A

Retinoblastoma-associated protein A domain
SMART ACC:SM001368
Description:This domain has the cyclin fold as predicted PMID:8152925, 9495340.
InterPro ACC:IPR002720
InterPro abstract:
GO process:regulation of cell cycle (GO:0051726)
GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 890 RB_A domains in 1 888 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RB_A domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RB_A domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RB_A domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RB_A domain which could be assigned to a KEGG orthologous group, and not all proteins containing RB_A domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002720
PfamRB_A