The Beach domain within your query sequence starts at position 2027 and ends at position 2307, and its E-value is 3.8e-209.

TQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQDYVSPVLDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVEPFTSLHVQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDLGCLQLTNEKVGDVVLPPWAGSPEDFIQKHRQALESEYVSTHLHEWIDLIFGYKQRGPAAEEALNVFYYCTYEGAVDLDHVADERERKALEGIISNFGQTPCQLLKEPHPPR
Beach

Beach

Beige/BEACH domain
SMART ACC:SM001026
Description:The BEACH domain was described in the BEIGE protein (D1035670) and in the highly homologous CHS protein. The BEACH domain is usually followed by a series of WD repeats. The function of the BEACH domain is unknown.
InterPro ACC:IPR000409
InterPro abstract:

The BEACH domain is usually followed by a series of WD repeats.

BEACH (Beige and Chediak-Higashi) domains, implicated in membrane trafficking, are present in a family of proteins conserved throughout eukaryotes. This group contains human lysosomal trafficking regulator (LYST), LPS-responsive and beige-like anchor (LRBA) and neurobeachin. Disruption of LYST leads to Chediak-Higashi syndrome … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 132 Beach domains in 8 120 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Beach domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Beach domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Beach domain which could be assigned to a KEGG orthologous group, and not all proteins containing Beach domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBeach
InterProIPR000409