The TSPc domain within your query sequence starts at position 109 and ends at position 308, and its E-value is 5.72e-69.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 21576514 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
129237SNo
TREELLAQIQRNIRHEVLEGNVGYLRVDDLPGQEVLSELGEFLVSHVWRQLMSTSSLVLDLRHCSGGHFSGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTP
TSPc

TSPc

tail specific protease
SMART ACC:SM000245
Description:tail specific protease
InterPro ACC:IPR005151
InterPro abstract:

This entry represents a domain found in the tail-specific proteases, such as retinol-binding protein 3 (also known as IRBP) from animals, C-terminal processing peptidases from algae and tricorn proteases from archaea. This domain share structural similarity with the crotonase fold that is formed from repeated β/β/α units, which comprises two perpendicular β-sheet surrounded by α-helices.

GO process:proteolysis (GO:0006508)
GO function:serine-type peptidase activity (GO:0008236)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 36 024 TSPc domains in 35 205 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TSPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TSPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TSPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing TSPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005151