The Arrestin_C domain within your query sequence starts at position 180 and ends at position 307, and its E-value is 2.14e-28.

TRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGSTRAVQPRAALVQTQTFMARGARKQKRAVVASVDGEPVGPNRRALWPGRALRIPPVGPSILQCRVLSVDYSLKVFVDIPGSSKLLLELPLVIGTVPL
Arrestin_C

Arrestin_C

Arrestin (or S-antigen), C-terminal domain
SMART ACC:SM001017
Description:Ig-like beta-sandwich fold. Scop reports duplication with N-terminal domain. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) (PUBMED:7720881), which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction (PUBMED:8452755), (PUBMED:1517224), (PUBMED:2158671).
InterPro ACC:IPR011022
InterPro abstract:

Arrestins comprise a family of closely-related proteins. In addition to the inactivation of G protein-coupled receptors, arrestins have been implicated in the endocytosis of receptors and cross talk with other signalling pathways. S-Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 903 Arrestin_C domains in 9 566 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Arrestin_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Arrestin_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Arrestin_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Arrestin_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Arrestin_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011022
PfamArrestin_C