The GEL domain within your query sequence starts at position 515 and ends at position 601, and its E-value is 7.31e-30.

TRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGK
GEL

GEL

Gelsolin homology domain
SMART ACC:SM000262
Description:Gelsolin/severin/villin homology domain. Calcium-binding and actin-binding. Both intra- and extracellular domains.
InterPro ACC:IPR007122
InterPro abstract:

Gelsolin is an actin-modulating protein that severs F-actin, caps the barbed ends of actin filaments preventing monomer exchange, and promotes the nucleation step of actin polymerisation [ PUBMED:14527663 PUBMED:3023087 ]. It can be regulated … expand

GO function:actin filament binding (GO:0051015)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 34 141 GEL domains in 8 112 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GEL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GEL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Calcium, actin

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the GEL domain.

ProteinDescriptionDisease / phenotype
GELS_HUMANOMIM:137350 : Amyloidosis, Finnish type
OMIM:105120 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GEL domain which could be assigned to a KEGG orthologous group, and not all proteins containing GEL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007122
PfamGelsolin