The UreE_C domain within your query sequence starts at position 72 and ends at position 262, and its E-value is 4.98e0.

TRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGVGGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRSAQANKGWEAAARERLQ
UreE_C

UreE_C

UreE urease accessory protein, C-terminal domain
SMART ACC:SM000987
Description:UreE is a urease accessory protein. Urease hydrolyses urea into ammonia and carbamic acid. The C-terminal region of members of this family contains a His rich Nickel binding site.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 48 577 UreE_C domains in 48 571 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UreE_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UreE_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the UreE_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UreE_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing UreE_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUreE_C