The ZU5 domain within your query sequence starts at position 439 and ends at position 542, and its E-value is 3.68e-58.

TSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEG
ZU5

ZU5

Domain present in ZO-1 and Unc5-like netrin receptors
SMART ACC:SM000218
Description:Domain of unknown function.
InterPro ACC:IPR000906
InterPro abstract:

The ZU5 domain is a domain of 90-110 residues present in zona occludens 1 (ZO-1) protein, in unc5-like netrin receptors and in ankyrins. The ZU5 domain is named after the mouse tight junction protein ZO-1 and the C. elegans uncoordinated protein 5 (unc-5) and related Unc5-like netrin receptors. ZU5 domains are found in eukaryotic proteins that in most cases contain a C-terminal death domain. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 021 ZU5 domains in 4 021 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZU5 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZU5 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZU5 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZU5 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZU5 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000906
PfamZU5