The GS domain within your query sequence starts at position 171 and ends at position 201, and its E-value is 1.01e-14.

TTLKDLIYDMTTSGSGSGLPLLVQRTIARTI
GS

GS

GS motif
SMART ACC:SM000467
Description:Aa approx. 30 amino acid motif that precedes the kinase domain in types I and II TGF beta receptors. Mutation of two or more of the serines or threonines in the TTSGSGSG of TGF-beta type I receptor impairs phosphorylation and signaling activity.
InterPro ACC:IPR003605
InterPro abstract:

Transforming growth factor beta (TGF-beta) is a member of a large family of secreted growth factors of central importance in eukaryotic development and homeostasis. Members of this family, which includes the activins, inhibins and bone morphogenic proteins (BMPs), bind to receptors that consist of two transmembrane serine/threonine (Ser/Thr) kinases called the type I and type II receptors. Type … expand

GO process:protein phosphorylation (GO:0006468)
GO component:membrane (GO:0016020)
GO function:transmembrane receptor protein serine/threonine kinase activity (GO:0004675), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 153 GS domains in 3 145 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GS domain which could be assigned to a KEGG orthologous group, and not all proteins containing GS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003605