The DUF3454 domain within your query sequence starts at position 2453 and ends at position 2517, and its E-value is 2.01e-30.

TTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPT
DUF3454

DUF3454

Domain of unknown function
SMART ACC:SM001334
Description: -
InterPro ACC:IPR024600
InterPro abstract:

This domain can be found at the C terminus of notch and notch-related proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 108 DUF3454 domains in 1 107 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3454 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3454 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3454 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3454 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR024600
PfamDUF3454