The LAG1_DNAbind domain within your query sequence starts at position 34 and ends at position 165, and its E-value is 2.3e-90.

TVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNAD
LAG1_DNAbind

LAG1_DNAbind

LAG1, DNA binding
SMART ACC:SM001267
Description:Members of this family are found in various eukaryotic hypothetical proteins and in the DNA-binding protein LAG-1. They adopt a beta sandwich structure, with nine strands in two beta-sheets, in a Greek-key topology, and allow for DNA binding (PUBMED:15297877). This domain is also known as RHR-N (Rel-homology region) as it related to Rel domain proteins.
InterPro ACC:IPR015351
InterPro abstract:

This domain is found in RBP-J from human and Cbf11/Cbf12 from fission yeast. These proteins function as transcription factors [ PUBMED:19101542 PUBMED:23303788 ]. This domain adopts a β sandwich structure, with nine strands in two β-sheets … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677), DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 473 LAG1_DNAbind domains in 1 470 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LAG1_DNAbind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LAG1_DNAbind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LAG1_DNAbind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LAG1_DNAbind domain which could be assigned to a KEGG orthologous group, and not all proteins containing LAG1_DNAbind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015351
PfamLAG1-DNAbind