The IGv domain within your query sequence starts at position 35 and ends at position 117, and its E-value is 1.2e-29.

TVSLTCTVTGYSITNGNHWWNWIRQVSGSKLEWIGYISSSGSTDSNPSLKSRISITRDTSKNQLFLQLNSVTTEDIATYYCAR
IGv

IGv

Immunoglobulin V-Type
SMART ACC:SM000406
Description: -
InterPro ACC:IPR013106
InterPro abstract:

This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 25 606 IGv domains in 24 468 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IGv domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IGv domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IGv domain.

ProteinDescriptionDisease / phenotype
MYP0_HUMANOMIM:159440 : Charcot-Marie-Tooth neuropathy-1B
OMIM:118200 : Dejerine-Sottas disease, myelin P-zero-related
OMIM:145900 : Hypomyelination, congenital
FGFR2_HUMANOMIM:176943 : Crouzon syndrome
OMIM:123500 : Jackson-Weiss syndrome
OMIM:123150 : Beare-Stevenson cutis gyrata syndrome
OMIM:123790 : Pfeiffer syndrome
OMIM:101600 : Apert syndrome
OMIM:101200 : Saethre-Chotzen syndrome
PVR_HUMANOMIM:173850 : {Polio, susceptibility to}

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IGv domain which could be assigned to a KEGG orthologous group, and not all proteins containing IGv domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamig
InterProIPR013106