The A2M domain within your query sequence starts at position 738 and ends at position 828, and its E-value is 2.31e-39.

TWIWDLVIVDSTGVAEMEVTVPDTITEWKAGAFCLSNDTGLGLSPVIDFQAFQPFFVDLTMPYSVIRGEAFTLKATVLNYLQTCIRVGVQL
A2M

A2M

Alpha-2-macroglobulin family
SMART ACC:SM001360
Description:This family includes the C-terminal region of the alpha-2-macroglobulin family.
InterPro ACC:IPR001599
InterPro abstract:

This entry contains serum complement C3 and C4 precursors and alpha-macrogrobulins.

The alpha-macroglobulin (aM) family of proteins includes protease inhibitors [ PUBMED:2473064 PUBMED:34970276 ], typified by the human tetrameric a2-macroglobulin … expand

GO function:endopeptidase inhibitor activity (GO:0004866)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 149 A2M domains in 15 090 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing A2M domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing A2M domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the A2M domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a A2M domain which could be assigned to a KEGG orthologous group, and not all proteins containing A2M domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001599
PfamA2M