The L51_S25_CI-B8 domain within your query sequence starts at position 36 and ends at position 109, and its E-value is 8.78e-16.

TYGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIKKILGKK
L51_S25_CI-B8

L51_S25_CI-B8

Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
SMART ACC:SM000916
Description:Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) . It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins.
InterPro ACC:IPR007741
InterPro abstract:

Proteins containing this domain are located in the mitochondrion and include large ribosomal subunit protein mL43 (known as MRPL51) and mL61 (MRP49), and small ribosomal subunit protein mS25 (S25). This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) EC:7.1.1.2. It is not known whether … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 843 L51_S25_CI-B8 domains in 3 831 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing L51_S25_CI-B8 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing L51_S25_CI-B8 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a L51_S25_CI-B8 domain which could be assigned to a KEGG orthologous group, and not all proteins containing L51_S25_CI-B8 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamL51_S25_CI-B8
InterProIPR007741