The FISNA domain within your query sequence starts at position 128 and ends at position 201, and its E-value is 1.71e-24.

TYKDYVRRKFQLMEDRNARLGECVNLSNRYTRLLLVKEHSNPIWTQQKFVDVEWERSRTRRHQTSPIQMETLFE
FISNA

FISNA

Fish-specific NACHT associated domain
SMART ACC:SM001288
Description:This domain is frequently found associated with the NACHT domain (PFAM: PF05729) in fish and other vertebrates PMID:18039395.
InterPro ACC:IPR029495
InterPro abstract:

This domain is frequently found associated with the NACHT domain ( IPR007111 ) in fish and other vertebrates [ PUBMED:18039395 ]. Proteins containing this domain include NACHT, LRR and PYD domains-containing protein 3/12 (NLRP3/12). … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 755 FISNA domains in 5 693 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FISNA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FISNA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FISNA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FISNA domain which could be assigned to a KEGG orthologous group, and not all proteins containing FISNA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFISNA
InterProIPR029495