The TOG domain within your query sequence starts at position 640 and ends at position 878, and its E-value is 7.51e-1.

TYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDFTNSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNG
TOG

TOG

SMART ACC:SM001349
Description:XMAP215/Dis1 proteins, such as Alp14 and XMAP215, increase microtubules dynamic polymerization rates by recruiting soluble αβ-tubulin via their conserved TOG domains to polymerizing microtubule plus ends.
InterPro ACC:IPR034085
InterPro abstract:

XMAP215/Dis1 proteins, such as Alp14 and XMAP215, increase microtubules dynamic polymerization rates by recruiting soluble alpha/beta-tubulin via their conserved TOG domains to polymerizing microtubule plus ends [ PUBMED:21782439 PUBMED:24630105 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 108 TOG domains in 5 624 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TOG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TOG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TOG domain which could be assigned to a KEGG orthologous group, and not all proteins containing TOG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR034085