The SEA domain within your query sequence starts at position 706 and ends at position 821, and its E-value is 8.88e-2.

VAQKLAGNVRITSMQYSESFLNTSSREHREFVELFFRTVRDSLPATLRQHMDAGRIRVDIINITNGSIVVEFNLLMTADLDVREVSAGFLNALQNTSMLEVVRGKTFMQDYNECDM
SEA

SEA

Domain found in sea urchin sperm protein, enterokinase, agrin
SMART ACC:SM000200
Description:Proposed function of regulating or binding carbohydrate sidechains.
InterPro ACC:IPR000082
InterPro abstract:

The SEA domain has been named after the first three proteins in which it was identified (Sperm protein, Enterokinase and Agrin). The SEA domain has around 120 residues, it is an extracellular domain found in a number of cell surface and secreted proteins in which it could be present in one or two copies [ PUBMED:27977898 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 947 SEA domains in 4 988 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SEA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SEA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SEA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SEA domain which could be assigned to a KEGG orthologous group, and not all proteins containing SEA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000082