The HDc domain within your query sequence starts at position 349 and ends at position 524, and its E-value is 1.12e-2.

VAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQW
HDc

HDc

Metal dependent phosphohydrolases with conserved 'HD' motif.
SMART ACC:SM000471
Description:Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).
InterPro ACC:IPR003607
InterPro abstract:

This entry represents the HD domain, which is found in a superfamily of enzymes with a predicted or known phosphohydrolase activity. It also represents a related phosphodiesterase (PDEase) domain that is found in eukaryotic 3',5'-cGMP phosphodiesterase ( EC:3.1.4.17 ), which is located in photoreceptor outer segments and it is … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 209 505 HDc domains in 208 022 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HDc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HDc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HDc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HDc domain.

ProteinDescriptionDisease / phenotype
PDE6B_HUMANOMIM:180072 : Night blindness, congenital stationary, type 3
OMIM:163500 : Retinitis pigmentosa, autosomal recessive

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HDc domain which could be assigned to a KEGG orthologous group, and not all proteins containing HDc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003607