The Tower domain within your query sequence starts at position 2752 and ends at position 2793, and its E-value is 2.37e-18.

VEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTE
Tower

Tower

SMART ACC:SM001341
Description:Members of this family adopt a secondary structure consisting of a pair of long, antiparallel alpha-helices (the stem) that support a three-helix bundle (3HB) at their end. The 3HB contains a helix-turn-helix motif and is similar to the DNA binding domains of the bacterial site-specific recombinases, and of eukaryotic Myb and homeodomain transcription factors. The Tower domain has an important role in the tumor suppressor function of BRCA2, and is essential for appropriate binding of BRCA2 to DNA (PMID:12228710).
InterPro ACC:IPR015205
InterPro abstract:

This domain adopts a secondary structure consisting of a pair of long, antiparallel α-helices (the stem) that support a three-helix bundle (3HB) at their end. The 3HB contains a helix-turn-helix motif and is similar to the DNA binding domains of the bacterial site-specific recombinases, and of eukaryotic Myb and homeodomain transcription factors. The Tower domain has an important role in the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 392 Tower domains in 392 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Tower domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Tower domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Tower domain which could be assigned to a KEGG orthologous group, and not all proteins containing Tower domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTower
InterProIPR015205