The Fibrillarin domain within your query sequence starts at position 94 and ends at position 321, and its E-value is 9.92e-176.

VEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Fibrillarin

Fibrillarin

SMART ACC:SM001206
Description: -
InterPro ACC:IPR000692
InterPro abstract:

Fibrillarin (rRNA 2'-O-methyltransferase fibrillarin) is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP) [ PUBMED:2026646 PUBMED:8493104 ]. It is a S-adenosyl-L-methionine-dependent methyltransferase that has the ability to … expand

GO process:rRNA processing (GO:0006364)
GO function:RNA binding (GO:0003723), methyltransferase activity (GO:0008168)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 925 Fibrillarin domains in 2 924 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Fibrillarin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Fibrillarin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Fibrillarin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Fibrillarin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Fibrillarin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFibrillarin
InterProIPR000692